Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOL1R2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | NOL1R2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170655
|
Novus Biologicals
NBP170655 |
100 μL |
Each of 1 for $436.00
|
|
Description
NOL1R2 Polyclonal specifically detects NOL1R2 in Human samples. It is validated for Western Blot.Specifications
NOL1R2 | |
Polyclonal | |
Purified | |
RUO | |
NSUN5C, NSUN5P2 NOP2/Sun domain family, member 5 pseudogene 2, WBSCR20B, WBSCR20C | |
NSUN5C | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
260294 | |
Synthetic peptides corresponding to NSUN5C(NOL1/NOP2/Sun domain family, member 5C) The peptide sequence was selected from the middle region of NSUN5C. Peptide sequence PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title