NOMO1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179566

Catalog No. NBP179566

Description

NOMO1 Polyclonal specifically detects NOMO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NOMO1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_055102
• Gene Symbols: NOMO1
• Immunogen: Synthetic peptide directed towards the C terminal of human NOMO1The immunogen for this antibody is NOMO1. Peptide sequence QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: NODAL modulator 1, Nomo, NOMO3, pM5 protein 3, pM5 protein, telomeric copy
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23420
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.