Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NOP56 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen NOP56
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157358
View Documents
Novus Biologicals
NBP157358
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

NOP56 Polyclonal specifically detects NOP56 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

NOP56
Polyclonal
Rabbit
O00567
10528
Synthetic peptides corresponding to NOL5A(nucleolar protein 5A (56kDa with KKE/D repeat)) The peptide sequence was selected from the middle region of NOL5A. Peptide sequence YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
NOL5A, NOP56 ribonucleoprotein homolog (yeast), nucleolar protein 56, Nucleolar protein 5A, nucleolar protein 5A (56kD with KKE/D repeat), nucleolar protein 5A (56kDa with KKE/D repeat)
NOP56
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit