Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NOP56 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NOP56 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157358
|
Novus Biologicals
NBP157358 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NOP56 Polyclonal specifically detects NOP56 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NOP56 | |
| Polyclonal | |
| Rabbit | |
| O00567 | |
| 10528 | |
| Synthetic peptides corresponding to NOL5A(nucleolar protein 5A (56kDa with KKE/D repeat)) The peptide sequence was selected from the middle region of NOL5A. Peptide sequence YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| NOL5A, NOP56 ribonucleoprotein homolog (yeast), nucleolar protein 56, Nucleolar protein 5A, nucleolar protein 5A (56kD with KKE/D repeat), nucleolar protein 5A (56kDa with KKE/D repeat) | |
| NOP56 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title