Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Citidine Deaminase Protein
Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity
$398.00 - $1110.00
Specifications
Concentration | 0.5mg/mL |
---|---|
For Use With (Application) | ELISA, SDS-PAGE |
Formulation | Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 1mM DTT, 2mM EDTA, 100mM NaCl, 40% Glycerol |
Gene ID (Entrez) | 978 |
Molecular Weight (g/mol) | 18.3kDa |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP14930601
|
Novus Biologicals™
NBP1493060.1MG |
0.1mg |
Each for $398.00
|
|
|||||
NBP1493065
|
Novus Biologicals™
NBP1493060.5MG |
0.5mg |
Each for $1,110.00
|
|
|||||
Description
A bioactive recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-146 of Human Citidine Deaminase The Recombinant Human Citidine Deaminase Protein is derived from E. coli. The Recombinant Human Citidine Deaminase Protein has been validated for the following applications: Functional, SDS-Page, Bioactivity.Specifications
0.5mg/mL | |
Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 1mM DTT, 2mM EDTA, 100mM NaCl, 40% Glycerol | |
18.3kDa | |
Human | |
Store at -80°C. Avoid freeze-thaw cycles. | |
Citidine Deaminase | |
>90% |
ELISA, SDS-PAGE | |
978 | |
Protein | |
Citidine Deaminase, 1-146aa. MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ | |
RUO | |
Unconjugated |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title