Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ dUTPase Protein
Highly purified. Generating reliable and reproducible results.
Supplier: Novus Biologicals™ NBP1485980.1MG
Description
A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 70-252 of Human dUTPase The Recombinant Human dUTPase Protein is derived from E. coli. The Recombinant Human dUTPase Protein has been validated for the following applications: SDS-Page.Specifications
1mg/mL | |
Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl. | |
21.6kDa | |
0.1mg | |
dUTPase 70-252 aa MGSSHHHHHHSSGLVPRGSHMASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN | |
RUO | |
Unconjugated |
ELISA, SDS-PAGE | |
1854 | |
Protein | |
Human | |
Store at -80°C. Avoid freeze-thaw cycles. | |
dUTPase | |
>90% |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction