Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ Human FGF acidic/FGF1 Protein
Highly purified and high bioactivity. Generating reliable and reproducible results.
Supplier: Novus Biologicals™ NBP226558
Description
Recombinant biologically active FGF1 protein. Source:E. coli Amino Acid Sequence: MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD The Recombinant Human FGF acidic/FGF1 Protein is derived from E. coli. The Recombinant Human FGF acidic/FGF1 Protein has been validated for the following applications: Bioactivity.Specifications
2246 | |
SDS-PAGE | |
Human |
FGF acidic/FGF1 protein | |
4°C short term, −20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction