Invitrogen™ NPY Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595226

Catalog No. PIPA595226

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: Mouse Brain Tissue, Rat Brain Tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase, regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases.

Specifications

• Antigen: NPY
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: NPY
• Gene Alias: 0710005A05Rik; C-flanking peptide of NPY; CPON; involved in appetite regulation; LOC100912228; Neuropeptide tyrosine; Neuropeptide Y; neuropeptide Y precursor; Neuropeptide-Y; Npy; NPY02; OTTHUMP00000201947; prepro-neuropeptide Y; proneuropeptide Y; pro-neuropeptide Y; pro-neuropeptide Y-like; PYY4; RATNPY; RATNPY02
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 100912228, 109648, 24604, 4852
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P01303, P07808, P57774
• Gene Symbols: NPY
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG