Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NRBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15496920UL

 View more versions of this product

Catalog No. NBP15496920


Add to cart

Description

Description

NRBP2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

NRBP2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
NRBP2
Synthetic peptides corresponding to NRBP2(nuclear receptor binding protein 2) The peptide sequence was selected from the middle region of NRBP2. Peptide sequence VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL.
30 kDa
20ul
Protein Kinase
Primary
340371
Western Blot
Western Blot 1:100-1:2000
Q9NSY0
DKFZp434P086, MGC138699, nuclear receptor binding protein 2, nuclear receptor-binding protein 2, pp9320, Transformation-related gene 16 protein, transformation-related protein 16, TRG16, TRG-16
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit