Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | NRBP2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15496920
|
Novus Biologicals
NBP15496920UL |
20 μL |
Each for $152.22
|
|
NBP154969
|
Novus Biologicals
NBP154969 |
100 μL |
Each for $436.00
|
|
Description
NRBP2 Polyclonal specifically detects NRBP2 in Human samples. It is validated for Western Blot.Specifications
| NRBP2 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q9NSY0 | |
| 340371 | |
| Synthetic peptides corresponding to NRBP2(nuclear receptor binding protein 2) The peptide sequence was selected from the middle region of NRBP2. Peptide sequence VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434P086, MGC138699, nuclear receptor binding protein 2, nuclear receptor-binding protein 2, pp9320, Transformation-related gene 16 protein, transformation-related protein 16, TRG16, TRG-16 | |
| NRBP2 | |
| IgG | |
| Affinity Purified | |
| 30 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title