Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NRBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen NRBP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15496920
View Documents
Novus Biologicals
NBP15496920UL
20 μL
Each for $152.22
Add to cart
 
NBP154969
View Documents
Novus Biologicals
NBP154969
100 μL
Each for $436.00
Add to cart
 
Description

Description

NRBP2 Polyclonal specifically detects NRBP2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NRBP2
Polyclonal
Rabbit
Protein Kinase
Q9NSY0
340371
Synthetic peptides corresponding to NRBP2(nuclear receptor binding protein 2) The peptide sequence was selected from the middle region of NRBP2. Peptide sequence VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp434P086, MGC138699, nuclear receptor binding protein 2, nuclear receptor-binding protein 2, pp9320, Transformation-related gene 16 protein, transformation-related protein 16, TRG16, TRG-16
NRBP2
IgG
Affinity Purified
30 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit