NrCAM Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159490

Catalog No. NBP159490

Description

NrCAM Polyclonal specifically detects NrCAM in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NrCAM
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q4KMQ7
• Gene Symbols: NRCAM
• Immunogen: Synthetic peptides corresponding to NRCAM(neuronal cell adhesion molecule) The peptide sequence was selected from the N terminal of NRCAM. Peptide sequence PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%; Chicken: 92%; Rabbit: 92%; Xenopus: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bravo, hBravo, KIAA0343Neuronal surface protein Bravo, MGC138845, MGC138846, neuronal cell adhesion molecule, Ng-CAM-related, NgCAM-related cell adhesion molecule, nr-CAM
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4897
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.