NRIF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159187

Catalog No. NBP159187

Description

NRIF3 Polyclonal specifically detects NRIF3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NRIF3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13352
• Gene Symbols: ITGB3BP
• Immunogen: Synthetic peptides corresponding to ITGB3BP(integrin beta 3 binding protein (beta3-endonexin)) The peptide sequence was selected from the N terminal of ITGB3BP (NP_055103). Peptide sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta-3-endonexin, CENP-R, centromere protein R, HSU37139, integrin beta 3 binding protein (beta3-endonexin), Integrin beta-3-binding protein, NRIF3CENPRbeta 3 endonexin, Nuclear receptor-interacting factor 3, TAP20
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 23421
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.