Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NRIF3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159187

 View more versions of this product

Catalog No. NBP159187


Add to Cart

Description

Description

NRIF3 Polyclonal specifically detects NRIF3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NRIF3
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
beta-3-endonexin, CENP-R, centromere protein R, HSU37139, integrin beta 3 binding protein (beta3-endonexin), Integrin beta-3-binding protein, NRIF3CENPRbeta 3 endonexin, Nuclear receptor-interacting factor 3, TAP20
Rabbit
20 kDa
100 μL
Apoptosis
23421
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q13352
ITGB3BP
Synthetic peptides corresponding to ITGB3BP(integrin beta 3 binding protein (beta3-endonexin)) The peptide sequence was selected from the N terminal of ITGB3BP (NP_055103). Peptide sequence TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE.
Affinity purified
RUO
Primary
Expected identity based on immunogen sequence: Human: 100%.
Human
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit