Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NSP 5 alpha 3 alpha Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen NSP 5 alpha 3 alpha
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123720
View Documents
Novus Biologicals
NBP30940925UL
25 μg
Each for $106.19
Add to cart
 
NB123719
View Documents
Novus Biologicals
NBP309409100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

NSP 5 alpha 3 alpha Polyclonal antibody specifically detects NSP 5 alpha 3 alpha in Human samples. It is validated for Western Blot
Specifications

Specifications

NSP 5 alpha 3 alpha
Western Blot
Purified
RUO
Human
cytospin-B, CYTSBcytospin B, FLJ36955, HCMOGT-1, NSP, NSP5, Nuclear structure protein 5, sperm antigen HCMOGT 1, Sperm antigen HCMOGT-1, sperm antigen with calponin homology and coiled coil domains 1, sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B, sperm antigen with calponin-like and coiled coil domains 1, structure protein NSP5a3a, structure protein NSP5a3b, structure protein NSP5b3a, structure protein NSP5b3b
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NSP 5 alpha 3 alpha (NP_690868). Peptide sequence RTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEK
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Neuroscience
PBS buffer, 2% sucrose
92521
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit