Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NT5M Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NT5M |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154684
|
Novus Biologicals
NBP154684 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NT5M Polyclonal specifically detects NT5M in Human samples. It is validated for Western Blot.Specifications
| NT5M | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Q9NPB1 | |
| 56953 | |
| Synthetic peptides corresponding to NT5M(5',3'-nucleotidase, mitochondrial) The peptide sequence was selected from the middle region of NT5M. Peptide sequence KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 3'-nucleotidase, mitochondrialDNT2, 5', 5' nucleotidase, mitochondrial, 5(3)-deoxyribonucleotidase, Deoxy-5'-nucleotidase 2, dNT2, dNT-25'(3')-deoxyribonucleotidase, mitochondrial, EC 3.1.3, EC 3.1.3.-, mdN, mitochondrial 5' nucleotidase | |
| NT5M | |
| IgG | |
| Affinity Purified | |
| 23 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title