NTB-A/SLAMF6/CD352 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162353

Catalog No. NBP162353

Description

NTB-A/SLAMF6/CD352 Polyclonal specifically detects NTB-A/SLAMF6/CD352 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NTB-A/SLAMF6/CD352
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B2R8X8
• Gene Symbols: SLAMF6
• Immunogen: Synthetic peptides corresponding to SLAMF6(SLAM family member 6) The peptide sequence was selected from the N terminal of SLAMF6. Peptide sequence NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Activating NK receptor, CD352 antigen, KALIFLJ50657, Ly108, NK-T-B-antigen, NTBA receptor, NTB-AMGC104953, NTBAT- and B-cell antigen, SF2000, SLAM family member 6
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 114836
• Target Species: Human
• Isotype: IgG