Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NTB-A/SLAMF6/CD352 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | NTB-A/SLAMF6/CD352 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162353
|
Novus Biologicals
NBP162353 |
100 μL |
Each of 1 for $436.00
|
|
Description
NTB-A/SLAMF6/CD352 Polyclonal specifically detects NTB-A/SLAMF6/CD352 in Human samples. It is validated for Western Blot.Specifications
NTB-A/SLAMF6/CD352 | |
Polyclonal | |
Rabbit | |
Human | |
B2R8X8 | |
114836 | |
Synthetic peptides corresponding to SLAMF6(SLAM family member 6) The peptide sequence was selected from the N terminal of SLAMF6. Peptide sequence NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Activating NK receptor, CD352 antigen, KALIFLJ50657, Ly108, NK-T-B-antigen, NTBA receptor, NTB-AMGC104953, NTBAT- and B-cell antigen, SF2000, SLAM family member 6 | |
SLAMF6 | |
IgG | |
Affinity Purified | |
34 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title