Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NTB-A/SLAMF6/CD352 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen NTB-A/SLAMF6/CD352
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162353
View Documents
Novus Biologicals
NBP162353
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

NTB-A/SLAMF6/CD352 Polyclonal specifically detects NTB-A/SLAMF6/CD352 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NTB-A/SLAMF6/CD352
Polyclonal
Rabbit
Human
B2R8X8
114836
Synthetic peptides corresponding to SLAMF6(SLAM family member 6) The peptide sequence was selected from the N terminal of SLAMF6. Peptide sequence NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
Activating NK receptor, CD352 antigen, KALIFLJ50657, Ly108, NK-T-B-antigen, NTBA receptor, NTB-AMGC104953, NTBAT- and B-cell antigen, SF2000, SLAM family member 6
SLAMF6
IgG
Affinity Purified
34 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit