Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | NUBP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157039
|
Novus Biologicals
NBP157039 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
NUBP1 Polyclonal specifically detects NUBP1 in Human samples. It is validated for Western Blot.Specifications
| NUBP1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cytosolic Fe-S cluster assembly factor NUBP1, MGC117406, MGC130053, NBP 1, NBP1, NBPMGC130052, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli), Nucleotide-binding protein 1 | |
| NUBP1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P53384 | |
| 4682 | |
| Synthetic peptides corresponding to NUBP1 (nucleotide binding protein 1 (MinD homolog, E. coli)) The peptide sequence was selected from the N terminal of NUBP1. Peptide sequence MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title