Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nuclear Factor Erythroid Derived 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen Nuclear Factor Erythroid Derived 2
Immunogen Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16922620 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16922620UL
20ul Each for $149.00
Add to cart
 
NBP169226 View Documents Novus BiologicalsSupplier Diversity Partner
NBP169226
100 ul Each for $329.00
Add to cart
 
Description

Description

Nuclear Factor Erythroid Derived 2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

Nuclear Factor Erythroid Derived 2
Rabbit
Polyclonal
Unconjugated
4778
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to NFE2 (nuclear factor (erythroid-derived 2), 45kDa) The peptide sequence was selected from the N terminal of NFE2. Peptide sequence MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP.
Primary
IgG
Leucine zipper protein NF-E2, NF-E2, nuclear factor (erythroid-derived 2), 45kD, nuclear factor (erythroid-derived 2), 45kDa, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45, p45 NF-E2, transcription factor NF-E2 45 kDa subunit
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit