Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nucleoplasmin-2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Nucleoplasmin-2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP158109
|
Novus Biologicals
NBP158109 |
100 μL |
Each of 1 for $436.00
|
|
Description
Nucleoplasmin-2 Polyclonal specifically detects Nucleoplasmin-2 in Human samples. It is validated for Western Blot.Specifications
Nucleoplasmin-2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC78655, nucleophosmin/nucleoplasmin 2, nucleoplasmin-2 | |
NPM2 | |
IgG | |
Affinity Purified | |
24 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q86SE8 | |
10361 | |
Synthetic peptides corresponding to NPM2(nucleophosmin/nucleoplasmin, 2) The peptide sequence was selected from the N terminal of NPM2 (NP_877724). Peptide sequence LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title