Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDCD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | NUDCD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155000
|
Novus Biologicals
NBP155000 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
NUDCD1 Polyclonal specifically detects NUDCD1 in Human samples. It is validated for Western Blot.Specifications
NUDCD1 | |
Polyclonal | |
Rabbit | |
Q96RS6 | |
84955 | |
Synthetic peptides corresponding to NUDCD1(NudC domain containing 1) The peptide sequence was selected from the N terminal of NUDCD1. Peptide sequence EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Chronic myelogenous leukemia tumor antigen 66, CML66OVA66, FLJ14991, NudC domain containing 1, nudC domain-containing protein 1, Tumor antigen CML66 | |
NUDCD1 | |
IgG | |
67 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title