Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDT13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15492920UL
Description
NUDT13 Polyclonal specifically detects NUDT13 in Human samples. It is validated for Western Blot.Specifications
NUDT13 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q86X67 | |
NUDT13 | |
Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY. | |
Affinity Purified | |
RUO | |
25961 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp586P2219, EC 3.-, nucleoside diphosphate-linked moiety X motif 13, nudix (nucleoside diphosphate linked moiety X)-type motif 13, Nudix motif 13, Protein KiSS-16 | |
Rabbit | |
40 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction