Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NUDT13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen NUDT13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15492920
View Documents
Novus Biologicals
NBP15492920UL
20 μL
Each for $152.22
Add to cart
 
NBP154929
View Documents
Novus Biologicals
NBP154929
100 μL
Each for $436.00
Add to cart
 
Description

Description

NUDT13 Polyclonal specifically detects NUDT13 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NUDT13
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp586P2219, EC 3.-, nucleoside diphosphate-linked moiety X motif 13, nudix (nucleoside diphosphate linked moiety X)-type motif 13, Nudix motif 13, Protein KiSS-16
NUDT13
IgG
Affinity Purified
40 kDa
Western Blot
Unconjugated
RUO
Q86X67
25961
Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit