Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDT13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | NUDT13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15492920
|
Novus Biologicals
NBP15492920UL |
20 μL |
Each for $152.22
|
|
NBP154929
|
Novus Biologicals
NBP154929 |
100 μL |
Each for $436.00
|
|
Description
NUDT13 Polyclonal specifically detects NUDT13 in Human samples. It is validated for Western Blot.Specifications
| NUDT13 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp586P2219, EC 3.-, nucleoside diphosphate-linked moiety X motif 13, nudix (nucleoside diphosphate linked moiety X)-type motif 13, Nudix motif 13, Protein KiSS-16 | |
| NUDT13 | |
| IgG | |
| Affinity Purified | |
| 40 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q86X67 | |
| 25961 | |
| Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title