Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDT16L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15543220UL
Description
NUDT16L1 Polyclonal specifically detects NUDT16L1 in Human samples. It is validated for Western Blot.Specifications
NUDT16L1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9BRJ7 | |
NUDT16L1 | |
Synthetic peptides corresponding to NUDT16L1(nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1) The peptide sequence was selected from the C terminal of NUDT16L1. Peptide sequence GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLN | |
Protein A purified | |
RUO | |
84309 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC11275, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1, protein syndesmos, SDOSNUDT16-like protein 1 | |
Rabbit | |
23 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction