Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUP133 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310998100UL
Description
NUP133 Polyclonal specifically detects NUP133 in Human samples. It is validated for Western Blot.Specifications
NUP133 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FLJ10814, hNUP133,133 kDa nucleoporin, MGC21133, nuclear pore complex protein Nup133, nucleoporin 133kD, nucleoporin 133kDa, Nucleoporin Nup133 | |
The immunogen is a synthetic peptide directed towards the middle region of human NUP133 (NP_060700.2). Peptide sequence QVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEK | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
55746 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction