Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NUP50 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257627

Catalog No. NBP257627


Add to cart

Description

Description

NUP50 Polyclonal antibody specifically detects NUP50 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

NUP50
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
50 kDa nucleoporin, MGC39961, NPAP60, NPAP60LNucleoporin Nup50, nuclear pore complex protein Nup50, Nuclear pore-associated protein 60 kDa-like, nuclear pore-associated protein 60L, nucleoporin 50kD, nucleoporin 50kDa
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
NUP50
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKR
Affinity purified
RUO
Primary
10762
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only