Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OAS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | OAS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15895220
|
Novus Biologicals
NBP15895220UL |
20 μL |
Each for $152.22
|
|
NBP158952
|
Novus Biologicals
NBP158952 |
100 μL |
Each for $436.00
|
|
Description
OAS2 Polyclonal specifically detects OAS2 in Human samples. It is validated for Western Blot.Specifications
| OAS2 | |
| Polyclonal | |
| Rabbit | |
| P29728 | |
| OAS2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 4939 | |
| Synthetic peptides corresponding to OAS2 (2'-5'-oligoadenylate synthetase 2, 69/71kDa). The peptide sequence was selected from the middle region of OAS2. Peptide sequence AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title