Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OATP1B3/SLCO1B3/OATP8 Mouse anti-Human, Clone: CL3770, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261636

Catalog No. NBP261636

Add to cart



OATP1B3/SLCO1B3/OATP8 Monoclonal antibody specifically detects OATP1B3/SLCO1B3/OATP8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.


Immunohistochemistry 1:200 - 1:500
This antibody was developed against a recombinant protein corresponding to amino acids: QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Protein A purified
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, LST2, LST-2, LST3, OATP1B3LST-3TM13, OATP8, OATP-8, Organic anion transporter 8, organic anion transporter LST-3c, Organic anion-transporting polypeptide 8, SLC21A8, solute carrier family 21 (organic anion transporter), member 8, Solute carrier family 21 member 8, solute carrier organic anion transporter family member 1B3, solute carrier organic anion transporter family, member 1B3
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit