Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OBCAM/OPCML Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP30942725UL

 View more versions of this product

Catalog No. NB123756

Add to cart



OBCAM/OPCML Polyclonal antibody specifically detects OBCAM/OPCML in Rat samples. It is validated for Western Blot


PBS buffer, 2% sucrose
IgLON family member 1, IGLON1opioid-binding protein/cell adhesion molecule-like, OBCAMopiate binding-cell adhesion molecule, OPCM, opioid binding protein/cell adhesion molecule-like, opioid binding protein/cell adhesion molecule-like preprotein, Opioid-binding cell adhesion molecule, opioid-binding protein/cell adhesion molecule
The immunogen for Anti-OBCAM/OPCML antibody is: synthetic peptide directed towards the C-terminal of Rat OPCM (NP_446300.1). Peptide sequence EDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNT
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1.0 ug/ml
Affinity purified
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit