Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OBFC2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258805

Catalog No. NBP258805


Add to cart

Description

Description

OBFC2A Polyclonal antibody specifically detects OBFC2A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

OBFC2A
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
DKFZp667M1322, FLJ13624, FLJ22833, hSSB2, MGC111163, oligonucleotide/oligosaccharide-binding fold containing 2A, Oligonucleotide/oligosaccharide-binding fold-containing protein 2A, Sensor of single-strand DNA complex subunit B2, Sensor of ssDNA subunit B2, SOSS complex subunit B2, SOSS-B2, SSB2Single-stranded DNA-binding protein 2
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
NABP1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFK
Affinity purified
RUO
Primary
64859
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only