Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Obox6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19161920UL
Description
Obox6 Polyclonal specifically detects Obox6 in Mouse samples. It is validated for Western Blot.Specifications
Obox6 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_663756 | |
OBOX6 | |
Synthetic peptide directed towards the middle region of mouse OBOX6. Peptide sequence MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES. | |
20 μL | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
oocyte specific homeobox 6 | |
Rabbit | |
Protein A purified | |
RUO | |
252830 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction