Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OCT6. Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen OCT6.
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry-Paraffin
Applications Western Blot, Immunohistochemistry (Paraffin)
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126826
View Documents
Novus Biologicals
NBP31096325UL
25 μg
Each for $106.19
Add to cart
 
NB126825
View Documents
Novus Biologicals
NBP310963100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

OCT6. Polyclonal antibody specifically detects OCT6. in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry (Paraffin)
Specifications

Specifications

OCT6.
Western Blot, Immunohistochemistry (Paraffin)
Purified
RUO
Human, Rat
Oct-6, OCT6POU domain transcription factor SCIP, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF6, OTF-6, POU class 3 homeobox 1, POU domain class 3, transcription factor 1, POU domain, class 3, transcription factor 1, SCIP
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat OCT6 (NP_620193). Peptide sequence CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry-Paraffin
Unconjugated
Rabbit
Cellular Markers
PBS buffer, 2% sucrose
5453
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit