Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Olfactory receptor 1537 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310239100UL
Description
Olfactory receptor 1537 Polyclonal specifically detects Olfactory receptor 1537 in Mouse samples. It is validated for Western Blot.Specifications
Olfactory receptor 1537 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
K4, MOR171, MOR171-32P, MOR171-41P, Olfr, Olfr144, Olfr1537-ps1 | |
The immunogen is a synthetic peptide directed towards the middle region of mouse OLFR144 (NP_997548.1). Peptide sequence AFTYLQPSSLNSMGQAKVSSVFYTTVVPMLNPLIYSLRNKDVSIALKKIL | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
257959 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction