Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ONECUT3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191528

 View more versions of this product

Catalog No. NBP191528


Add to cart

Description

Description

ONECUT3 Polyclonal antibody specifically detects ONECUT3 in Human, Mouse, Rat, Porcine, Bovine, Canine samples. It is validated for Western Blot.
Specifications

Specifications

ONECUT3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
OC3, OC-3, one cut domain family member 3, one cut domain, family member 3, one cut homeobox 3, transcription factor ONECUT-3
Rabbit
IgG
Protein A purified
RUO
Primary
390874
Bovine, Canine, Human, Mouse, Porcine, Rat
Western Blot
Western Blot 1:1000
Purified
ONECUT3
Synthetic peptide directed towards the C terminal of human LOC390874. Peptide sequence ETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLVFTD.
54 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit