Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ONECUT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19152820UL
Description
ONECUT3 Polyclonal specifically detects ONECUT3 in Human samples. It is validated for Western Blot.Specifications
ONECUT3 | |
Polyclonal | |
Western Blot 1:1000 | |
OC3, OC-3, one cut domain family member 3, one cut domain, family member 3, one cut homeobox 3, transcription factor ONECUT-3 | |
Rabbit | |
54 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
ONECUT3 | |
Synthetic peptide directed towards the C terminal of human LOC390874. Peptide sequence ETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLVFTD. | |
Protein A purified | |
RUO | |
390874 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction