Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Opsin 1 (Long Wave) Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen Opsin 1 (Long Wave)
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123686
View Documents
Novus Biologicals
NBP30939225UL
25 μg
Each for $106.19
Add to cart
 
NB123685
View Documents
Novus Biologicals
NBP309392100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

Opsin 1 (Long Wave) Polyclonal antibody specifically detects Opsin 1 (Long Wave) in Human, Mouse samples. It is validated for Western Blot
Specifications

Specifications

Opsin 1 (Long Wave)
Western Blot
Purified
RUO
Human, Mouse
CBBM, COD5, cone dystrophy 5 (X-linked), long-wave-sensitive opsin 1, opsin 1 (cone pigments), long-wave-sensitive, RCPcolor blindness, protan, Red cone photoreceptor pigmentCBP, Red-sensitive opsin, ROP
The immunogen is a synthetic peptide directed towards the C-terminal region of human OPN1MW. Peptide sequence SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
GPCR
PBS buffer, 2% sucrose
5956
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit