Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR10A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309845100UL
Description
OR10A4 Polyclonal specifically detects OR10A4 in Human samples. It is validated for Western Blot.Specifications
OR10A4 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
HP2, hP2 olfactory receptor, JCG5, olfactory receptor 10A4, olfactory receptor OR11-87, olfactory receptor, family 10, subfamily A, member 4, olfactory receptor, family 10, subfamily A, member 4 pseudogene, Olfactory receptor-like protein JCG5, OR10A4P | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A4 (NP_997069). Peptide sequence TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
283297 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction