Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR10X1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen OR10X1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159629
missing translation for 'viewDocuments'
Novus Biologicals
NBP159629
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

OR10X1 Polyclonal specifically detects OR10X1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

OR10X1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
family 10, subfamily X, member 1 pseudogene, olfactory receptor, family 10, subfamily X, member 1, OR1-14
OR10X1
IgG
Affinity Purified
36 kDa
Western Blot
Unconjugated
RUO
Q8NGY0
128367
Synthetic peptides corresponding to OR10X1(olfactory receptor, family 10, subfamily X, member 1) The peptide sequence was selected from the middle region of OR10X1. Peptide sequence NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
missing translation for 'provideContentCorrection'

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

missing translation for 'productTitle'