Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR10X1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | OR10X1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159629
|
Novus Biologicals
NBP159629 |
100 μL |
Each of 1 for $436.00
|
|
Description
OR10X1 Polyclonal specifically detects OR10X1 in Human samples. It is validated for Western Blot.Specifications
OR10X1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family 10, subfamily X, member 1 pseudogene, olfactory receptor, family 10, subfamily X, member 1, OR1-14 | |
OR10X1 | |
IgG | |
Affinity Purified | |
36 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8NGY0 | |
128367 | |
Synthetic peptides corresponding to OR10X1(olfactory receptor, family 10, subfamily X, member 1) The peptide sequence was selected from the middle region of OR10X1. Peptide sequence NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
missing translation for 'provideContentCorrection'
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
missing translation for 'productTitle'