Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR13C5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | OR13C5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180011
|
Novus Biologicals
NBP180011 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
OR13C5 Polyclonal specifically detects OR13C5 in Human samples. It is validated for Western Blot.Specifications
| OR13C5 | |
| Polyclonal | |
| Rabbit | |
| NP_001004482 | |
| 138799 | |
| Synthetic peptide directed towards the N terminal of human OR13C5. Peptide sequence ICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| olfactory receptor 13C5, olfactory receptor, family 13, subfamily C, member 5 | |
| OR13C5 | |
| IgG | |
| 36 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title