Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR1A1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen OR1A1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124882
View Documents
Novus Biologicals
NBP30999025UL
25 μg
Each for $106.19
Add to cart
 
NB124881
View Documents
Novus Biologicals
NBP309990100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

OR1A1 Polyclonal antibody specifically detects OR1A1 in Rat samples. It is validated for Western Blot
Specifications

Specifications

OR1A1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
8383
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Rat
olfactory receptor 1A1, Olfactory receptor OR17-11, olfactory receptor, family 1, subfamily A, member 1, OR17-7Olfactory receptor 17-7
The immunogen is a synthetic peptide directed towards the C terminal region of rat OLR1514 (NP_055380.2). Peptide sequence YFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRI
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit