Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR1C1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | OR1C1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169093
|
Novus Biologicals
NBP169093 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
OR1C1 Polyclonal specifically detects OR1C1 in Human samples. It is validated for Western Blot.Specifications
OR1C1 | |
Polyclonal | |
Rabbit | |
GPCR | |
26188 | |
Synthetic peptides corresponding to OR1C1 (olfactory receptor, family 1, subfamily C, member 1) The peptide sequence was selected from the C terminal of OR1C1. Peptide sequence AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HSTPCR27, olfactory receptor 1C1, Olfactory receptor OR1-42, Olfactory receptor TPCR27, olfactory receptor, family 1, subfamily C, member 1, OR1.5.10, OR1-42, ORL211, TPCR27 | |
OR1C1 | |
IgG | |
35 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title