Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR1F1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen OR1F1
Dilution Western Blot 1.0 ug/ml, Antibody Array Analysis
Applications Western Blot, Peptide Array
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124417
View Documents
Novus Biologicals
NBP309758100UL
100 μg
Each for $352.89
Add to cart
 
NB124418
View Documents
Novus Biologicals
NBP30975825UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

OR1F1 Polyclonal antibody specifically detects OR1F1 in Human samples. It is validated for Western Blot, Antibody Array Analysis
Specifications

Specifications

OR1F1
Western Blot, Peptide Array
Purified
RUO
PBS buffer, 2% sucrose
4992
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Antibody Array Analysis
Unconjugated
Rabbit
Human
Olfactory receptor 16-35, olfactory receptor 1F1, Olfactory receptor 1F10, Olfactory receptor 1F4, Olfactory receptor 1F5, Olfactory receptor 1F6, Olfactory receptor 1F7, Olfactory receptor 1F8, Olfactory receptor 1F9, Olfactory receptor OR16-4, olfactory receptor, family 1, subfamily F, member 1, olfactory receptor, family 1, subfamily F, member 13 pseudogene, olfactory receptor, family 1, subfamily F, member 4, olfactory receptor, family 1, subfamily F, member 5, olfactory receptor, family 1, subfamily F, member 6, olfactory receptor, family 1, subfamily F, member 7, olfactory receptor, family 1, subfamily F, member 9, Olfmf, OLFMFolfactory receptor, family 1, subfamily F, member 10, OR16-35, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F10, OR1F13P, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR3-145, ORL1023
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1F1 (NP_036492.1). Peptide sequence FNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGALKKVVGRVV
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit