Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR1G1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | OR1G1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP168970
|
Novus Biologicals
NBP168970 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
OR1G1 Polyclonal specifically detects OR1G1 in Human samples. It is validated for Western Blot.Specifications
| OR1G1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Olfactory receptor 17-209, olfactory receptor 1G1, Olfactory receptor 1G2, Olfactory receptor OR17-8, olfactory receptor, family 1, subfamily G, member 1, olfactory receptor, family 1, subfamily G, member 2, OR17-209OR17-130, OR1G2 | |
| OR1G1 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P47890 | |
| 8390 | |
| Synthetic peptides corresponding to OR1G1 (olfactory receptor, family 1, subfamily G, member 1) The peptide sequence was selected from the C terminal of OR1G1. Peptide sequence FSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSSLRKLIWVRK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title