Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR1S1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168969

 View more versions of this product

Catalog No. NBP168969


Add to Cart

Description

Description

OR1S1 Polyclonal specifically detects OR1S1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

OR1S1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
olfactory receptor 1S1, Olfactory receptor OR11-232, olfactory receptor, family 1, subfamily S, member 1, OR11-232, OST034
Rabbit
37 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q8NGQ3
OR1S1
Synthetic peptides corresponding to OR1S1 (olfactory receptor, family 1, subfamily S, member 1) The peptide sequence was selected from the C terminal of OR1S1. Peptide sequence FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS.
Affinity purified
RUO
219959
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit