Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2AT4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | OR2AT4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159861
|
Novus Biologicals
NBP159861 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
OR2AT4 Polyclonal specifically detects OR2AT4 in Human samples. It is validated for Western Blot.Specifications
| OR2AT4 | |
| Polyclonal | |
| Rabbit | |
| A6NND4 | |
| 341152 | |
| Synthetic peptides corresponding to OR2AT4(olfactory receptor, family 2, subfamily AT, member 4) Antibody(against the N terminal of OR2AT4. Peptide sequence MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| olfactory receptor 2AT4, Olfactory receptor OR11-265, olfactory receptor OR11-265 pseudogene, olfactory receptor, family 2, subfamily AT, member 4, OR11-265 | |
| OR2AT4 | |
| IgG | |
| 35 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title