Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2F2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309768100UL
Description
OR2F2 Polyclonal specifically detects OR2F2 in Human samples. It is validated for Western Blot.Specifications
OR2F2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 2F2, Olfactory receptor OR7-6, olfactory receptor, family 2, subfamily F, member 2, OR7-1Olfactory receptor 7-1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2F2 (NP_001004685). Peptide sequence PHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGAWHKLLEKFSGL | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
135948 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction