Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2H2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309987100UL
Description
OR2H2 Polyclonal specifically detects OR2H2 in Mouse samples. It is validated for Western Blot.Specifications
OR2H2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FAT11, Hs6M1-12, MGC126732, MGC138381, Olfactory receptor 2, olfactory receptor 2H2, Olfactory receptor 2H3, olfactory receptor OR6-36, olfactory receptor, family 2, subfamily H, member 2, olfactory receptor, family 2, subfamily H, member 3, Olfactory receptor-like protein FAT11, OLFR2OLFR42B, OR2H3dJ271M21.2 | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR90 (NP_009091.3). Peptide sequence LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM | |
100 μg | |
Olfactory | |
7932 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction