Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2L8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | OR2L8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179773
|
Novus Biologicals
NBP179773 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
OR2L8 Polyclonal specifically detects OR2L8 in Human samples. It is validated for Western Blot.Specifications
| OR2L8 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| olfactory receptor 2L8, Olfactory receptor OR1-46, olfactory receptor, family 2, subfamily L, member 8 | |
| OR2L8 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001001963 | |
| 391190 | |
| The immunogen for this antibody is OR2L8. Peptide sequence TYLRPRSLRSPTEDKVLAVFYTILTPMLNPIIYSLRNKEVMGALTRVSQR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title