Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR4D10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen OR4D10
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124470
View Documents
Novus Biologicals
NBP30978425UL
25 μg
Each for $106.19
Add to cart
 
NB124469
View Documents
Novus Biologicals
NBP309784100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

OR4D10 Polyclonal antibody specifically detects OR4D10 in Human samples. It is validated for Western Blot
Specifications

Specifications

OR4D10
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
390197
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
olfactory receptor 4D10, Olfactory receptor OR11-251, olfactory receptor, family 4, subfamily D, member 10, olfactory receptor, family 4, subfamily D, member 10 pseudogene, OR11-251, OR4D10P, OST711, seven transmembrane helix receptor
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4D10 (NP_001004705). Peptide sequence FILELLMISNNGLLTTLWFFLLLVSYIVILSLPKSQAGEGRRKAISTCTS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit