Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR5B12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309797100UL
Description
OR5B12 Polyclonal specifically detects OR5B12 in Human samples. It is validated for Western Blot.Specifications
OR5B12 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241, olfactory receptor, family 5, subfamily B, member 12, olfactory receptor, family 5, subfamily B, member 12 pseudogene, olfactory receptor, family 5, subfamily B, member 16, OR11-241, OR5B12P, OR5B16, OST743 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5B12 (NP_001004733). Peptide sequence EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
390191 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction