Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR5H6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310252100UL
Description
OR5H6 Polyclonal specifically detects OR5H6 in Mouse samples. It is validated for Western Blot.Specifications
OR5H6 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
olfactory receptor 5H6, Olfactory receptor OR3-11, olfactory receptor, family 5, subfamily H, member 6, OR3-11 | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR5H6. Peptide sequence VHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSLAKFLKRNV | |
100 μg | |
Signal Transduction | |
79295 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Mouse | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction