Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR6C75 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | OR6C75 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159362
|
Novus Biologicals
NBP159362 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
OR6C75 Polyclonal specifically detects OR6C75 in Human samples. It is validated for Western Blot.Specifications
| OR6C75 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| olfactory receptor 6C75, olfactory receptor, family 6, subfamily C, member 75 | |
| OR6C75 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A6NL08 | |
| 390323 | |
| Synthetic peptides corresponding to OR6C75(olfactory receptor, family 6, subfamily C, member 75) The peptide sequence was selected from the middle region of OR6C75. Peptide sequence SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title